Web Analysis for Vashikaranspecialistsksharmag - vashikaranspecialistsksharmag.website
Online fast vashikaran specialist in India is suggesting tips for any problem solution mainly persons are using this service for love back solution in life.
2.67
Rating by CuteStat
It is a domain having website extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, vashikaranspecialistsksharmag.website is SAFE to browse.
PageSpeed Score
60
Siteadvisor Rating
Not Applicable
Traffic Report
| Daily Unique Visitors: | Not Applicable |
| Daily Pageviews: | Not Applicable |
Estimated Valuation
| Income Per Day: | $ 0.15 |
| Estimated Worth: | $ 8.95 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Not Applicable |
| WOT Child Safety: | Not Applicable |
Website Ranks & Scores
| Alexa Rank: | Not Applicable |
| Domain Authority: | Not Applicable |
Web Server Information
Hosted IP Address:
68.65.120.207
Hosted Country:
US
Location Latitude:
37.751Location Longitude:
-97.822Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
| H1 Headings: | 1 | H2 Headings: | 1 |
| H3 Headings: | Not Applicable | H4 Headings: | 2 |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | Not Applicable | Total Images: | 22 |
| Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 68.65.120.207)
Big Lake Heating and Cooling | Air-Conditioning Sales and Service
Not Applicable
$
8.95
Porn in sexy lingerie
Sex with a woman in beautiful lingerie
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Sun, 10 Mar 2019 11:55:49 GMT
Server: Apache
Last-Modified: Tue, 20 Nov 2018 19:50:04 GMT
Accept-Ranges: none
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 13400
Content-Type: text/html
Date: Sun, 10 Mar 2019 11:55:49 GMT
Server: Apache
Last-Modified: Tue, 20 Nov 2018 19:50:04 GMT
Accept-Ranges: none
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 13400
Content-Type: text/html
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| vashikaranspecialistsksharmag.website | A | 1196 |
IP: 68.65.120.207 |
| vashikaranspecialistsksharmag.website | NS | 10800 |
Target: dns1.namecheaphosting.com |
| vashikaranspecialistsksharmag.website | NS | 10800 |
Target: dns2.namecheaphosting.com |
| vashikaranspecialistsksharmag.website | SOA | 10796 |
MNAME: dns1.namecheaphosting.com RNAME: audit.namecheaphosting.com Serial: 2019030809 Refresh: 86400 Retry: 7200 Expire: 3600000 Minimum TTL: 86400 |
| vashikaranspecialistsksharmag.website | MX | 1200 |
Priority: 30 Target: smx3.web-hosting.com |
| vashikaranspecialistsksharmag.website | MX | 1200 |
Priority: 10 Target: smx1.web-hosting.com |
| vashikaranspecialistsksharmag.website | MX | 1200 |
Priority: 20 Target: smx2.web-hosting.com |
| vashikaranspecialistsksharmag.website | TXT | 1200 |
TXT: MAltYWlsLnZhc2hpa2FyYW5zcGVjaWFsaXN0c2tz aGFybWFnLndlYnNpdGUuCg== |
